PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00904.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 223aa    MW: 23260.6 Da    PI: 8.0802
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00904.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.21.2e-352784461
                   zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                             + l+cprC+s  tkfCyynny+l qPryfCk+CrryWt+GG+lr+vPvGgg+r++ ++
  Rsa1.0_00904.1_g00001.1 27 EPLPCPRCNSIITKFCYYNNYNLLQPRYFCKSCRRYWTQGGTLRDVPVGGGTRRSSSK 84
                             6789*************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.1E-312883IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.8852983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-193378IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MPSESNQTRP ARVQGSTAAY PPPNLAEPLP CPRCNSIITK FCYYNNYNLL QPRYFCKSCR  60
RYWTQGGTLR DVPVGGGTRR SSSKRNRSFS SNATTASSSS CSSSIITTAN GSEPMNQGTV  120
TNEAKGSNEI SGYGSFASLL SGQSDGAGFL ALGNGSGTGG LDYGFGYGYG LEEMSIGYLG  180
GGSGGEIPVV GGSDTWQIGV MEGKSGDSLW PGLEISMQSN GAK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00189DAPTransfer from AT1G47655Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0889461e-84AY088946.1 Arabidopsis thaliana clone 103581 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590549.11e-130PREDICTED: dof zinc finger protein DOF1.6
SwissprotQ9SX976e-80DOF16_ARATH; Dof zinc finger protein DOF1.6
TrEMBLA0A0D3CNY41e-130A0A0D3CNY4_BRAOL; Uncharacterized protein
STRINGBra015609.1-P1e-118(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94652435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G47655.12e-43Dof family protein